ACTH (Adrenocorticotropic Hormone)

Product Code: QA-ACTH01 CAS Number: 12279-41-3 (ACTH 1-39, human) Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF (1-39, human) Molecular Formula: C207H308N56O58S (1-39, human)

Overview

Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a 39-amino acid peptide hormone secreted by the anterior pituitary gland. It is a cleavage product of the proopiomelanocortin (POMC) precursor and serves as a key component of the hypothalamic-pituitary-adrenal (HPA) axis. ACTH stimulates corticosteroid secretion from the adrenal cortex through the melanocortin-2 receptor (MC2R/ACTH-R) in response to biological stress.

Key Features

• Full-length ACTH (1-39) and multiple fragment variants available
• Species-specific isoforms: human, rat, mouse, guinea pig
• Modified variants including biotinylated, acetylated, and D-amino acid substitutions
• Conserved ACTH (1-24) fragment retains ~75% potency across species

Product Specifications