Adrenomedullin (ADM)
Product Code: QA-ADM01 CAS Number: 148498-78-6 (ADM 1-52, human) Sequence: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (1-52, human) Molecular Formula: C264H406N80O77S3 (1-52, human)
Overview
Adrenomedullin (ADM) is a 52-amino acid endogenous vasodilatory peptide belonging to the calcitonin gene-related peptide (CGRP) superfamily. ADM and its receptors are widely distributed in vascular tissues and play pivotal roles in cardiovascular and lymphatic system regulation. The peptide contains an intramolecular disulfide bond essential for receptor binding.
Key Features
- Full-length and fragment peptides from multiple species (human, rat, pig)
- Correctly folded disulfide-bridged products
- Includes proadrenomedullin fragments for precursor studies
- CGRP superfamily member with vasodilatory activity
Product Specifications
| Parameter | Specification |
|---|---|
| Purity | ≥95% or ≥98% (HPLC verified) |
| Form | Lyophilized powder |
| Storage | -20°C, desiccated, protected from light |
| Research Use Only | Yes |
| Purity | ≥95% or ≥98% (HPLC verified) |
| Form | Lyophilized powder |
| Storage | -20°C, desiccated, protected from light |
| Research Use Only | Yes |