Adrenomedullin (ADM)

Product Code: QA-ADM01 CAS Number: 148498-78-6 (ADM 1-52, human) Sequence: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (1-52, human) Molecular Formula: C264H406N80O77S3 (1-52, human)

Overview

Adrenomedullin (ADM) is a 52-amino acid endogenous vasodilatory peptide belonging to the calcitonin gene-related peptide (CGRP) superfamily. ADM and its receptors are widely distributed in vascular tissues and play pivotal roles in cardiovascular and lymphatic system regulation. The peptide contains an intramolecular disulfide bond essential for receptor binding.

Key Features

Product Specifications

Parameter Specification
Purity ≥95% or ≥98% (HPLC verified)
Form Lyophilized powder
Storage -20°C, desiccated, protected from light
Research Use Only Yes
Purity ≥95% or ≥98% (HPLC verified)
Form Lyophilized powder
Storage -20°C, desiccated, protected from light
Research Use Only Yes

Request a Quote

Contact Dr. Aaron Wang for pricing, bulk orders, and custom specifications:

Email: aaron@senobiocorp.com
WhatsApp: +64 20 431 0558