Antimicrobial Peptides (AMPs)
Product Code: QA-AMP01 CAS Number: 597562-32-8 (LL-37, human) Sequence: [LL-37, 37 aa] (LL-37, human) Molecular Formula: C205H340N60O53
Overview
Antimicrobial peptides (AMPs) are evolutionarily conserved components of the innate immune system that provide the first line of defense against bacterial, fungal, and viral pathogens. QYAOBIO supplies synthetic AMPs including human LL-37 (cathelicidin), which exhibits broad-spectrum antimicrobial activity and additional immunomodulatory functions.
Key Features
- Human LL-37 (37-residue cathelicidin peptide)
- Amphipathic α-helical structure
- Broad-spectrum antimicrobial activity
- Immunomodulatory and wound-healing properties
Product Specifications
| Parameter | Specification |
|---|---|
| Purity | ≥95% or ≥98% (HPLC verified) |
| Form | Lyophilized powder |
| Storage | -20°C, desiccated, protected from light |
| Research Use Only | Yes |
| Purity | ≥95% or ≥98% (HPLC verified) |
| Form | Lyophilized powder |
| Storage | -20°C, desiccated, protected from light |
| Research Use Only | Yes |