Antimicrobial Peptides (AMPs)

Product Code: QA-AMP01 CAS Number: 597562-32-8 (LL-37, human) Sequence: [LL-37, 37 aa] (LL-37, human) Molecular Formula: C205H340N60O53

Overview

Antimicrobial peptides (AMPs) are evolutionarily conserved components of the innate immune system that provide the first line of defense against bacterial, fungal, and viral pathogens. QYAOBIO supplies synthetic AMPs including human LL-37 (cathelicidin), which exhibits broad-spectrum antimicrobial activity and additional immunomodulatory functions.

Key Features

Product Specifications

Parameter Specification
Purity ≥95% or ≥98% (HPLC verified)
Form Lyophilized powder
Storage -20°C, desiccated, protected from light
Research Use Only Yes
Purity ≥95% or ≥98% (HPLC verified)
Form Lyophilized powder
Storage -20°C, desiccated, protected from light
Research Use Only Yes

Request a Quote

Contact Dr. Aaron Wang for pricing, bulk orders, and custom specifications:

Email: aaron@senobiocorp.com
WhatsApp: +64 20 431 0558